PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo4G0108700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family TALE
Protein Properties Length: 665aa    MW: 72886.9 Da    PI: 7.1135
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo4G0108700genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.23.2e-093744111954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Spipo4G0108700 374 FEHflHPYPKDTDKLMLAKQTGLTRSQVSNWFINARVR 411
                     554459******************************88 PP

2BELL113.61e-36235306172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erqelq+kkakL ++l+eV++rY+qy++q q+v+ssFea+ag gsa+ YtslAl++iS+ FrcLkdai++qi
  Spipo4G0108700 235 ERQELQMKKAKLANMLDEVEQRYRQYHQQTQIVVSSFEAMAGFGSARTYTSLALQTISKRFRCLKDAIIGQI 306
                     79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.9E-54168304IPR006563POX domain
PfamPF075262.0E-46173302IPR006563POX domain
PROSITE profilePS5007112.001352415IPR001356Homeobox domain
CDDcd000864.17E-12355416No hitNo description
SMARTSM003893.2E-9355419IPR001356Homeobox domain
SuperFamilySSF466894.71E-17356422IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-28358422IPR009057Homeodomain-like
PfamPF059205.9E-18372411IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 665 aa     Download sequence    Send to blast
MATFFHGGAP EIQPDGLQTL YLMNPGYVGY PSDGSATSNM LLLNQAGVSA SSQSAHQHQL  60
LGIPLQNQVS ASSSSVDHSR PMSISVPHDI SAVHGSLPRV HYNLWNPTTN SGIDAAAQQL  120
RRPSMAPLAQ QGLSLSLSPQ QANYGPYRQD REMLVSPSST SEATNGMPGL QGMLMGSKYL  180
KAAQQLLDEV VNVGKGIKDD SPRVSKNLMK ASRDADEAAG EETGLKRAAE LTTVERQELQ  240
MKKAKLANML DEVEQRYRQY HQQTQIVVSS FEAMAGFGSA RTYTSLALQT ISKRFRCLKD  300
AIIGQIRATS KSLGEEDGQI GGGKGEGGSR LRFVDHHLRQ QRALQQLGMM QHNAWRPQRG  360
LPERAVSVLR AWLFEHFLHP YPKDTDKLML AKQTGLTRSQ VSNWFINARV RLWKPMVEEM  420
YMEETKDHEQ QHNNGDDRPS KRELNEDSGA PTEGSPSGTQ KQADSLLTRE DDSTDPKLHP  480
SMIPSSDLAG IIRMKETSAY GDDGSLSQEK FKKARAEEAS LHMNGLPHAM HMGMDFKPIA  540
TNRDFFTVNR RGVEDGGYSF GAFPMGDLGR FDPEQFAPRF SGNGVSLTLG LPHCDSLSLS  600
GTQPSFLSPE SIPLGRRLEI GGETGDFCNL RNNAPGAHPS NAFENINMQN RKGFAAPLLP  660
DFVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B2e-16361418158Homeobox protein Meis1
4xrs_A2e-16361418158Homeobox protein Meis1
5bng_A2e-16361419159Homeobox protein Meis2
5bng_B2e-16361419159Homeobox protein Meis2
3k2a_B3e-16361419563Homeobox protein Meis2
3k2a_A3e-16361419563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010247233.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_010247226.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_010247219.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_010247208.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_010247201.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_010247191.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_010247184.10.0PREDICTED: BEL1-like homeodomain protein 1
TrEMBLF6HAC50.0F6HAC5_VITVI; Putative uncharacterized protein
STRINGVIT_06s0009g00410.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48163758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-119BEL1-like homeodomain 1